Veeam the transport service is not responding or an ssh connection was not established.
Veeam the transport service is not responding or an ssh connection was not established In the SSH Port field, specify a number of the SSH port to connect to a Linux machine. Consequently, establishing a connection becomes impossible. Aug 3, 2023 · Some tasks may not display these errors and instead behave as if the SSH connection failed. The error, however, is still written in the logs: Warning Failed to establish SSH connection. 5) Disable SSH sudo systemctl stop ssh Future updates (v12 to a later version) will not require that process and SSH anymore Jun 16, 2022 · Failed to create VM recovery checkpoint (mode: Veeam application-aware processing) Details: Unable to perform application-aware processing because connection to the guest could not be established Error: Unable to perform application-aware processing because connection to the guest could not be established Dec 8, 2021 · This is not a known issue, so it must be something with the server or 3rd party software it has installed. Sep 23, 2022 · I checked the user account again for veeam and it’s a Domain Admin and i’m using it as a MasterAccount and it still fails. This may be increased as needed. Task failed. Nov 28, 2024 · The folder with the repository must be accessible for accounts with user permissions (and not only root). The packets tried to connect to the destination server over the iSCSI VLAN and not the normal “gateway” where it was supposed to traverse because of weighting not specified properly. Within the view selector in the bottom-left corner, select Backup Infrastructure. Deploying Veeam Agent for Linux Using Pre-installed Veeam Deployer Service; Deploying Veeam Agent for Unix; Deploying Veeam Agent for Mac; Adding Protection Group to Backup Job Aug 28, 2015 · Starting with Veeam Backup & Replication 11, an additional SSH library is used, allowing for an expanded list of supported Ciphers, Key Exchange Algorithms, and MAC Algorithms. To allow VIX to work you need several things: Mar 23, 2015 · The credentials test in a job for virtual machines fail on Linux credentials. Dec 6, 2022 · I'm having an issue with several different customers where the hardened Linux repo is losing its connection to the Veeam server after several days and no changes have been made it just stops working. Also, the SQL Server Express was stopped at this moment. A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond <ip Nov 5, 2024 · Hi everyone,I have 2 servers with VBR and I’m trying to connect one of those as a backup proxy of the other, so i can manage backups from a single backup server and disable the other one. Jun 28, 2023 · Normal Veeam Backup does not use databases to store the backup data. Of note is that I do not run as local admin. Within the tree in the Backup Infrastructure navigation pane, select Managed Servers. Warning No suitable authentication method found to complete authentication (password). Feb 22, 2017 · Veeam Community discussions and solutions for: Failed to establish SSL connection. I 100% drink the Veeam juice and fight to use it anywhere my career brings me. 0. Oct 9, 2022 · 1. Our User Administration removed the priviledge of "remote login" form the veeam user. The server is set to Automatic, so I'm not sure what's going on. Jul 5, 2013 · To do so, create the following registry value on the Veeam Backup server: Key Location: HKLM\SOFTWARE\Veeam\Veeam Backup and Replication\ Value Name: AgentMaxReconnectRetries Value Type: DWORD (32-bit) Value Value Data (Default): 30. Aug 27, 2023 · This could result from the service not running, or it might be listening on an alternative port. Now running "veeam" make blinking the screen, and "veeam --help" is an unknown argument. Quick glance at log: Mar 10, 2018 · 4/30/2018 10:10:18 AM :: Full backup file merge failed Error: Failed to connect to the Veeam Cloud Connect service Unable to connect to the service provider. 172, and everything was in the green. Windows patches were installed on all affected servers before Veeam patch. 310 to 12. May 17, 2023 · The following command disables the SSH service, so that it does not start automatically during boot time. Veeam server is Windows will be using Linux Hardened repository. Common. Type the ssh command in your terminal (there are two ways to ssh – one using a password and the other one is using a private key ) ssh command using private key and Public DNS: ssh -i private_key username@Public_DNS. Feb 12, 2021 · Veeam Community discussions and solutions for: Processing Error: Failed to connect to guest agent. Veeam tries first to connect by RPC and fallback to VIX. 4) Remove Repo User from Sudo sudo deluser repouser sudo. 2. Is this by design? I'd like to have other Windows users permissioned to at least startup the application. Feb 16, 2025 · Veeam Backup Hyper-V Integration Service (In) Veeam Data Mover (Veeam Transport Service) (In) Veeam Data Mover x64 (Veeam Transport Service) (In) Veeam Guest Interaction Proxy (In) Veeam Installer Service (In) Veeam Transport Service (In) Okay this is a weird problem, I have no idea. Jul 16, 2015 · Veeam Community discussions and solutions for: V12 Hardened Repository Upgrade an established connection was aborted by the server of Veeam Backup & Replication V12 Hardened Repository Upgrade an established connection was aborted by the server Sep 5, 2024 · I’m having an issue with backuping up one of my servers using Veeam Backup & Replication Version 12. From 12. My log files were showing that I was being rejected by the VBR server (not the repository). The Veeam Backup Service has an ‘Automatic (Delayed)’ start mode, so you can’t login right away after restarting your VBR server. VERA if you mount the Veeam ISO file on this server - go under Packages folder and run the VeeamDistributionSVC. The Veeam Backup Service is unable to start. You can continue working with SSH until the next reboot. 2) Add Repo User to Sudo sudo usermod -aG sudo repouser. For instance the linux credentials to Ubuntu VM's, the credentials to a VMware vCSA VM or a FreeBSD based VM. Jul 3, 2024 · Step 10. The transport service will be used to communicate with backup infrastructure components without the SSH connection. It just seems in this specific case, it is not being escalated properly. (Renci. I was able to complete the wizard and update the components. SshNet. Best regards Christian Apr 7, 2022 · Redeploy Veeam Transport Service to Linux Server. Below are the Because of this error, you will also notice that most of the Veeam services are not running. Finish Working with Wizard; Deploying Veeam Agents Using Generated Setup Files. By default, port 22 is used. I have checklist: Ip ping ist ok; domainname. Veeam Backup & Replication will upload and start Veeam Data Movers through the SSH connection when Veeam Backup & Replication addresses the server. Aug 13, 2019 · Veeam Backup & Replication will attempt to automatically open ports used by the Veeam Data Mover service. I then went through and tried to reconfigure the job when I noticed I had specified my AD credentials. This will help to ensure that it is possible to connect to the server outside of the Veeam software. If you find that the Veeam Backup Service on the Veeam Backup Server Apr 25, 2023 · I have setup a new Veeam Advanced version 12. After Veeam support told me how to check the logs, i found a few access denied errors. Its been 15 days and I keep on getting this error:Processing nServer NAME] Error: Connection problems. Veeam on the other hand only initially needs the credentials to deploy the transport service. Nov 14, 2019 · As an isolation step, try using PuTTY to make an SSH connection to the Linux server from the Veeam backup server using the same credentials that are specified in the Veeam backup console. Apr 2, 2019 · Looks like it was a permissions issue. Connected to domain and Windows Server 2019 install. The snapshot removal process significantly lowers the total IOPS that can be delivered by the VM because of additional locks on the VMFS storage due to the increase in metadata updates, as well as the added IOP load of the snapshot removal process itself. Oct 4, 2012 · Veeam does not remove the snapshot itself, Veeam sends an API call to VMware to have the action performed. e. 1. , hostname\Administrator) May 5, 2016 · 3/26/2023 10:06:49 PM Failed Connecting to Veeam Installer service on server Error: A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond x. (Preferred) Install the latest Windows updates on all Hyper-V hosts, the Veeam server, proxies, repositories (or gateway servers), and other servers involved in the backup process. but I think I've narrowed it down to the reason being the "Veeam Data Mover Service" not running since it's not running, and the backups appear to start correctly after I start the service. Or add the following key on all Hyper-V hosts, the Veeam server, proxies, repositories (or gateway servers), and other servers involved in the backup process. If the server was in the domain and a built-in domain administrator account was used (which is exempt from UAC), you wouldn't have encountered any issues. Jul 23, 2020 · Regarding Warning in VMware Environments. I am trying to add Linux server in Managed system till testing connection its all fine. Mar 17, 2021 · Interesting and maybe completely unrelated, yesterday I updated to latest Veeam v10 patch and I was unable to update the components (proxies etc) because the Veeam transport service was not removed during update (they were removed but the server was still running). *NOTE* In Veeam Backup & Replication version 11, persistent Veeam Data Movers are required for Linux servers with the backup proxy role assigned. I have installed first veeamsnap, next veeam. However, if that fails, you may need to configure the Linux server's firewall manually. If RPC is testing successfully, it is generally acceptable for the VIX test to fail as it will not likely be used. Jul 8, 2013 · Ensure the correct account is used. Cannot connect to the host's administrative share. msi-- this will install the service that Veeam is looking for and will hopefully let you upgrade at that point. So, for anyone encountering "an established connection was aborted by the server" when trying to upgrade components of a Linux hardened repository, Properties in Backup Infrastructure Apr 21, 2016 · The Veeam Backup Service has not started yet. Therefore ssh login didn't function any more. To resolve I have to ssh in and disable MFA and then elevate the veeeam user that I'm using for the single use credentials and then rescan in Veeam. SshAuthenticationException) Apr 20, 2011 · The "service veeamservice start" does not produce any reply. The transport service will run in the context of this user, so it still needs to be present on your Linux server. You can also stop the SSH service directly and the current SSH session will continue to work. of Veeam Backup & Replication Processing Error: Failed to connect to guest agent. Please respect these rules if you choose to participate in this community further. Please give our support a chance to respond to the support case and troubleshoot this for you. May 23, 2024 · Folks, I upgraded B&R yesterday from 12. sudo systemctl disable ssh. My password expired and I had to change my password on the Backup Server window. May 27, 2019 · The purpose of this forum is explained in great details following the red link displayed when you click New Topic. Jan 26, 2024 · we solved the problem. 3. 310. Mar 13, 2024 · The Veeam Backup Service could not assign itself port 10005 when it started because another application already used that port. 56 to 12. Error: Connection problems. Best, Fabian Feb 27, 2023 · Depending on what version you are using @Jrousset. Sep 1, 2021 · To be clear, I've only ever had great support and customer service from Veeam. Please review: Adding Linux Servers: Before You Begin for more information. I got it working in the end by enabling the built in Windows 10 Administrator account and then changing the credentials in Veeam to use this account instead of my own local user which was supposed to be an admin. is not a connection or firewall issue. 2. The Veeam Backup Service is set with the startup type "Automatic (Delayed Start)," this means that when the OS has just booted, it may take up to 3-5 minutes before the service starts. VIX - Veeam connects to the ESXi hosts and opens a network less connection to the VM by using the VIX communication channel of the VMware Tools. Jul 16, 2015 · I was told that there was no installer service and that the transport service needed to be upgraded. Dec 14, 2022 · If the persistent Veeam Data Mover service cannot be installed on the Linux server, a non-persistent Data Mover agent will be uploaded to the /tmp/ folder and run via an SSH connection each time Veeam Backup & Replication interacts with the Linux Server. SSH connection is necessary only for the deployment of Veeam Data Mover, or transport service. RPC is faster than VIX. I am using Veeam 11 version. Thanks. The default is 30 retries. After that the job ran fine. This timeout is used to wait for connection to the Aug 20, 2019 · I'd also add that this is actually not a Veeam-specific but a general remote WMI connection specific issue, so you will hardly find another software that will work as you expect with this setup. of Veeam Agent for Microsoft Windows Sep 3, 2024 · So I have the same issue. Jan 10, 2024 · Our Veeam environment is configured to utilize vSphere backup tags (which includes both Windows and Linux VMs). After the upgrade to v12. You need either a VPN connection between the agent and the backup server or Veeam Cloud Connect (as a Service provider or Veeam Cloud Connect for Enterprise if you are an eligible customer). local pin ok; Windows FW Deaktiv; Veeam Server ist domain member; Join ist with Domain\Administrator; i have add Regedit LocalAccountTokenFilterPolicy DWORD 1; I did this check, they are all working. I install the worker, it works for 2-3 days and then I get these: Failed to obtain an IP address issues. It is still unclear, why other ssh logins were still working. Jul 13, 2015 · Failed to open management RPC connection ro proxy service Port 6162 etc. Deploying Veeam Agent for Microsoft Windows; Deploying Veeam Agent for Linux. 1 our backup jobs that included Linux VMs didn’t backup. That's why you use 'single use credentials' as Veeam doesn't need to save those credentials. In the SSH Timeout field, specify the SSH connection timeout. The connection to the SP Veeam Backup Server will not be authenticated unless the Tenant Veeam Backup Server can validate a certificate that ends with a Root CA certificate. We added the priviledge again and all is fine. To diagnose the problem, you can try running the netstat -anb command from the command line to check if anything is listening on the intended port. NAT for Veeam Agents is not supported by veeam. Open the Veeam Backup & Replication Console. Aug 10, 2021 · The "Failed to start service / connect to Veeam" and "connection refused". Generally speaking, this is controlled by a line in the /etc/ssh/sshd_config file starting with: Apr 1, 2025 · In the Passphrase field, specify a passphrase for the private key on the Veeam Backup for Microsoft 365 server. But whenever i try to login through terminal using ssh command: ssh root@{ip_address} I get error: Connection closed by {ip_address} I checked hosts Mar 2, 2022 · Option 2: Configure sshd to allow SFTP Review the sshd configuration on the Linux server you are attempting to add to Veeam Backup & Replication and enable SFTP. Once you perform those 2 steps, you can then either manually assign this specific Proxy to your Jobs as needed, or allow Mar 17, 2015 · In this case, Veeam Data Movers will be non-persistent. It´s not working yet, but the thread can be closed All other Veeam services are not relevant to be able to connect the console to Veeam. I am trying to ssh login to my remote server. Within the working area, identify and edit the entry for the Linux server. ssh command using private key and Public IP address: Feb 15, 2010 · While we haven't hit this problem directly, it appears the Veeam UI can only be successfully started and used by the Windows Service account which has either installed the product, or is running the Veeam Backup & Replication service. So if you can connect by RPC there is no need to fix the VIX connection. x. Upon troubleshooting, I try to start the VM manually, and it doesn’t boot (doesn’t even reach BIOS) and CPU is 90%+. If you encounter similar issue, please endeavour to review the log file. Jul 26, 2017 · The certificate chain has not been fully installed on the SP Veeam Backup Server, and as a result, the chain of trust cannot be established. Aug 30, 2024 · 30-8-2024 15:41:29 Connection to the worker core service was established successfully 30-8-2024 15:41:29 Connection between the worker and backup server was established successfully 30-8-2024 15:41:34 Connection between the worker and cluster was established successfully Jul 16, 2024 · "PowerShell environment initialization failed: Failed to connect to Veeam Backup & Replication server: A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond" Sometimes it also comes with this message: Dec 20, 2023 · After you've finished configuring your Linux server for the Transport method you are using, you then need to add your Linux server as a managed server in Veeam, then go through the Add Proxy > VMware Backup Proxy process. I tried on another Veeam server but still the same however when i’m trying to add the cluster nodes separately `Computer Objects` not a cluster it success. Thank you, Andrea Aug 27, 2023 · This could result from the service not running, or it might be listening on an alternative port. Mar 15, 2022 · Yes this is new configuration i am testing this for the first time as we are planning to implement Veeam with Immutability option. However, we have two physical Linux machines, and when the backup job for them ran, I got a warning that the servers have "an outdated Data Mover service version". Nov 19, 2014 · If so, that was wrong. May 29, 2013 · Matt, if the automatic upgrade procedure fails, I believe you can copy the Veeam Transport Service setup package located in C:\Program Files\Veeam\Backup and Replication\Backup\Packages folder (by default) to upgrade the proxy. adding the server as general purpose and CDP proxy works just fine but when I try to add it as vmware proxy it s Feb 28, 2022 · If it‘s NAT, then I wonder how it have worked until now. com", an once the CA root was inserted into the trusted store, it helped to go to next level. A firewall in the environment is blocking traffic between the machine where Veeam Agent for Microsoft Windows is installed and the Veeam Backup Server. But even with Veeam Backup & Replication I wouldn’t use it as a backup target :) I prefer Object Storage or a hardened repository (Linux with XFS filesystem). Jan 6, 2025 · I migrated 2 Veeam Backup & Replication servers on 2 new ones, using the veeam procedure (stop old, install new, point to the same mssql db, then restore config on itself (for credentials)). Still 100% a Veeam fanboy though Mar 9, 2023 · 1) Enable SSH sudo systemctl start ssh. We have opened up a support call, and in the meantime have a work around. microsoft. But you can no longer reconnect after stopping the SSH service. Therefore, it is highly recommended to use the latest version of Veeam Backup & Replication to ensure maximum compatibility. On former server I was not having the issue, but i do have it on the new one… connect on IP is ok, connect on hostname is not. I don’t know why actually. . Apr 23, 2021 · A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond I then turn off the firewall and I get the following error: Unknown host type 'ws' Any ideas? Oct 18, 2021 · SSH into a Linux Server using a private key or password. 3) Update Backup Repo in VBR Console with Single Use Credentials. , hostname\Administrator) Jul 8, 2013 · Ensure the correct account is used. To use VIX for Guest Processing, one of the two following accounts must be specified for Guest Processing: The Built-in Administrator (i. Try to put the entire folder structure on an iSCSI volume and see if it works better. Jan 25, 2022 · Now, i´m ready to close this thread, because I found one more CA cert not trusted in the chain, when accessing "graph. x:6160 0:01:25 Feb 24, 2022 · I had a customer who had iSCSI VLAN configured with a gateway specified on the NIC for his configuration. In VMware environments, Veeam Backup & Replication can use two methods to connect to a guest: RPC or VIX. skvxuezwrawfatqpklmeeptrskqypvemmhftmohrlbwxbdvazgwkpgsjjopdyktxtnrincyvyas